PDB entry 1ikf

View 1ikf on RCSB PDB site
Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Class: immune system/immunosuppressant
Keywords: immune system-immunosuppressant complex, fab-cyclosporin complex, cyclosporin a, immunosuppressant
Deposited on 1993-12-09, released 1995-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.164
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: cyclosporin a
    Species: Tolypocladium inflatum, synthetic [TaxId:29910]
    Database cross-references and differences (RAF-indexed):
    • NOR NOR00033 (0-10)
  • Chain 'H':
    Compound: igg1-kappa r45-45-11 fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IKF (0-227)
    Domains in SCOPe 2.06: d1ikfh1, d1ikfh2
  • Chain 'L':
    Compound: igg1-kappa r45-45-11 fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IKF (0-213)
    Domains in SCOPe 2.06: d1ikfl1, d1ikfl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfH (H:)
    evklvesggglvqpggslklscatsgftfsdyymywvrqnsekrlewvafisngggsafy
    adivkgrftisrdnakntlylqmsrlksedtamyyctrhtlydtlygnypvwfadwgqgt
    lvtvsaakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfp
    avlqsdlytlsssvtvpsssrpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ikfL (L:)
    diqmtqttsslsaslgdrvtiscrasqdistylnwyqqkpdgtvkllifytsrlrsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgsripptfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnraac