PDB entry 1ik0

View 1ik0 on RCSB PDB site
Description: Solution Structure of Human IL-13
Class: cytokine
Keywords: left-handed four-helix bundle, CYTOKINE
Deposited on 2001-05-01, released 2002-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-13
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35225 (1-112)
    • cloning artifact (0)
  Domains in SCOPe 2.07: d1ik0a1, d1ik0a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ik0A (A:)
  mgpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
  ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn