PDB entry 1ijq

View 1ijq on RCSB PDB site
Description: Crystal Structure of the LDL Receptor YWTD-EGF Domain Pair
Class: lipid transport
Keywords: beta-propeller, LIPID TRANSPORT
Deposited on 2001-04-27, released 2001-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.208
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijqa1, d1ijqa2
  • Chain 'B':
    Compound: low-density lipoprotein receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: LDLR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijqb1, d1ijqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijqA (A:)
    iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqld
    rahgvssydtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengs
    kpraivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlyw
    vdsklhsissidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgs
    dvnllaenllspedmvlfhnltqprgvnwcerttlsnggcqylclpapqinphspkftca
    cpdgmllardmrsclt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijqA (A:)
    iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqly
    dtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengskpraivvd
    pvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlywvdsklhsi
    ssidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgsdvnllaen
    llspedmvlfhnltqprgvnwcerttlsnggcqylclpapqinphspkftcacpdgmlla
    rdmrsclt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ijqB (B:)
    iaylfftnrhevrkmtldrseytslipnlrnvvaldtevasnriywsdlsqrmicstqld
    rahgvssydtvisrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengs
    kpraivvdpvhgfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlyw
    vdsklhsissidvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgs
    dvnllaenllspedmvlfhnltqprgvnwcerttlsnggcqylclpapqinphspkftca
    cpdgmllardmrsclt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijqB (B:)
    iaylfftnrhevrkmtlseytslipnlrnvvaldtevasnriywsdlsqrmicstqydtv
    isrdiqapdglavdwihsniywtdsvlgtvsvadtkgvkrktlfrengskpraivvdpvh
    gfmywtdwgtpakikkgglngvdiyslvteniqwpngitldllsgrlywvdsklhsissi
    dvnggnrktiledekrlahpfslavfedkvfwtdiineaifsanrltgsdvnllaenlls
    pedmvlfhnltqprgvnwcerttlsnggcqylclpapqinphspkftcacpdgmllardm
    rsclt