PDB entry 1ijk

View 1ijk on RCSB PDB site
Description: The von Willebrand Factor mutant (I546V) A1 domain-botrocetin Complex
Class: blood clotting/toxin
Keywords: Dinucleotide-binding fold, C-type lectin fold, BLOOD CLOTTING/TOXIN COMPLEX
Deposited on 2001-04-26, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275
      • engineered (46)
    Domains in SCOPe 2.07: d1ijka_
  • Chain 'B':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijkb_
  • Chain 'C':
    Compound: Botrocetin
    Species: Bothrops jararaca [TaxId:8724]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ijkc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ijkA (A:)
    sepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyh
    dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
    llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
    vdeleqqrdeivsylcdlapea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijkA (A:)
    pplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyhdg
    shayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialll
    masqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvd
    eleqqrdeivsylcdlape
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ijkB (B:)
    dcpsgwssyegncykffqqkmnwadaerfcseqakgghlvsikiyskekdfvgdlvtkni
    qssdlyawiglrvenkekqcssewsdgssvsyenvvertvkkcfalekdlgfvlwinlyc
    aqknpfvcksppp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ijkC (C:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrsltsemlk
    gdvvwiglsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfv
    cefqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ijkC (C:)
    dcppdwssyeghcyrffkewmhwddaeefcteqqtgahlvsfqskeeadfvrslgdvvwi
    glsdvwnkcrfewtdgmefdyddyyliaeyecvaskptnnkwwiipctrfknfvcefqa