PDB entry 1ijb

View 1ijb on RCSB PDB site
Description: The von Willebrand Factor mutant (I546V) A1 domain
Class: blood clotting
Keywords: Dinucleotide-binding fold, BLOOD CLOTTING
Deposited on 2001-04-25, released 2002-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: von willebrand factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04275 (0-201)
      • engineered (46)
    Domains in SCOPe 2.08: d1ijba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ijbA (A:)
sepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyh
dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
vdeleqqrdeivsylcdlapea