PDB entry 1ij9

View 1ij9 on RCSB PDB site
Description: Highly Hydrated Human VCAM-1 Fragment
Deposited on 2001-04-25, released 2001-05-02
The last revision prior to the SCOP 1.67 freeze date was dated 2001-11-07, with a file datestamp of 2001-11-07.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ij9A (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvy