PDB entry 1ij9

View 1ij9 on RCSB PDB site
Description: Highly Hydrated Human VCAM-1 Fragment
Class: cell adhesion
Keywords: integrin solvation, CELL ADHESION
Deposited on 2001-04-25, released 2001-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.208
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vascular cell adhesion protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ij9a1, d1ij9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ij9A (A:)
    fkiettpesrylaqigdsvsltcsttgcespffswrtqidsplngkvtnegttstltmnp
    vsfgnehsylctatcesrklekgiqveiysfpkdpeihlsgpleagkpitvkcsvadvyp
    fdrleidllkgdhlmksqefledadrksletkslevtftpviedigkvlvcraklhidem
    dsvptvrqavkelqvy