PDB entry 1ij6

View 1ij6 on RCSB PDB site
Description: ca2+-bound structure of multidomain ef-hand protein, cbp40, from true slime mold
Class: metal binding protein
Keywords: fourty kda calcium binding protein, cbp40, metal binding protein
Deposited on 2001-04-25, released 2003-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.249
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmodial specific lav1-2 protein
    Species: Physarum polycephalum [TaxId:5791]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ij6a_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ij6A (A:)
    eifsqeltqreanvkkvhenleelqkkldhtsfahkedrdrleaqiaqkeqeqkaklaey
    dqkvqnefdareraerereaargdaaaekqrlasllkdleddasgynrlrpskpmlseed
    tnilrqlflssavsgsgkfsfqdlkqvlakyadtipegplkklfvmvendtkgrmsyitl
    vavandlaalvadfrkidtnsngtlsrkefrehfvrlgfdkksvqdalfryadedesddv
    gfseyvhlglcllvlrilyafadfdksgqlskeevqkvledahipesarkkfehqfsvvd
    vddskslsyqefvmlvllmfhdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ij6A (A:)
    eifsqeltqreanvkkvhenleelqkkldhtsfahdrleaqiaqkeqeqkaklaeydqkv
    qnefdareraerereaargdaaaekqrlasllkdlekpmlseedtnilrqlflssavsgs
    gkfsfqdlkqvlakyadtipegplkklfvmvendtkgrmsyitlvavandlaalvadfrk
    idtnsngtlsrkefrehfvrlgfdkksvqdalfryadedesddvgfseyvhlglcllvlr
    ilyafadfdksgqlskeevqkvledahipesarkkfehqfsvvdvddskslsyqefvmlv
    llmfh