PDB entry 1iiz

View 1iiz on RCSB PDB site
Description: Crystal Structure of the Induced Antibacterial Protein from Tasar Silkworm, Antheraea mylitta
Class: hydrolase
Keywords: hydrolase
Deposited on 2001-04-24, released 2001-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.231
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Antheraea mylitta [TaxId:34739]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7SID7 (0-119)
  Domains in SCOPe 2.06: d1iiza_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iizA (A:)
  krftrcglvnelrkqgfdenlmrdwvclvenesarytdkianvnkngsrdyglfqindky
  wcskgstpgkdcnvtcsqlltdditvastcakkiykrtkfdawsgwdnhcnhsnpdissc