PDB entry 1iix

View 1iix on RCSB PDB site
Description: Crystal Structure of a Human Fcg Receptor in Complex with an Fc Fragment of IgG1 (hexagonal)
Deposited on 2001-04-24, released 2001-05-09
The last revision prior to the SCOP 1.57 freeze date was dated 2001-05-16, with a file datestamp of 2001-05-16.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.247
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iixA (A:)
    lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreq
    qynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvytlpps
    reemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdk
    srwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iixB (B:)
    apellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktk
    preqqynstyrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakgqprepqvyt
    lppsreemtknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskl
    tvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iixC (C:)
    lpkavvflepqwysvlekdsvtlkcqgayspednstqwfhneslissqassyfidaatvn
    dsgeyrcqtnlstlsdpvqlevhigwlllqaprwvfkeedpihlrchswkntalhkvtyl
    qngkdrkyfhhnsdfhipkatlkdsgsyfcrglvgsknvssetvnit