PDB entry 1iio

View 1iio on RCSB PDB site
Description: nmr-based structure of the conserved protein mth865 from the archea methanobacterium thermoautotrophicum
Deposited on 2001-04-23, released 2001-10-17
The last revision prior to the SCOP 1.65 freeze date was dated 2001-10-17, with a file datestamp of 2001-10-17.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.65: d1iioa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iioA (A:)
  gshmkmgvkedirgqiigalagadfpinspeelmaalpngpdttcksgdvelkasdagqv
  ltaddfpfksaeevadtivnkagl