PDB entry 1ii2

View 1ii2 on RCSB PDB site
Description: Crystal Structure of Phosphoenolpyruvate Carboxykinase (PEPCK) from Trypanosoma cruzi
Class: lyase
Keywords: Phosphate binding loop, LYASE
Deposited on 2001-04-20, released 2001-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ii2a1, d1ii2a2
  • Chain 'B':
    Compound: phosphoenolpyruvate carboxykinase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ii2b1, d1ii2b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ii2A (A:)
    pptihrnllspelvqwalkiekdsrltargalavmsyaktgrspldkrivdtddvrenvd
    wgkvnmklseesfarvrkiakefldtrehlfvvdcfaghderyrlkvrvfttrpyhalfm
    rdmlivptpeelatfgepdyviynageckadpsipgltsttcvalnfktreqvilgteya
    gemkkgiltvmfelmpqmnhlcmhasanvgkqgdvtvffglsgtgkttlsadphrnligd
    dehvwtdrgvfnieggcyakaiglnpktekdiydavrfgavaencvldkrtgeidfydes
    ickntrvayplshiegalskaiaghpknvifltndafgvmppvarltsaqamfwfvmgyt
    anvpgveaggtrtarpifsscfggpflvrhatfygeqlaekmqkhnsrvwllntgyaggr
    adrgakrmplrvtraiidaihdgtldrteyeeypgwglhipkyvakvpehllnprkawkd
    vrqfnetskelvamfqesfsarfaakasqemksavpryvefarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii2A (A:)
    pptihrnllspelvqwalkiekdsrltargalavmsyaktgrspldkrivdtddvrenvd
    wgkvnmklseesfarvrkiakefldtrehlfvvdcfaghderyrlkvrvfttrpyhalfm
    rdmlivptpeelatfgepdyviynageckadpsipgltsttcvalnfktreqvilgteya
    gemkkgiltvmfelmpqmnhlcmhasanvgkqgdvtvffglsgtgkttlsadphrnligd
    dehvwtdrgvfnieggcyakaiglnpktekdiydavrfgavaencvldkrtgeidfydes
    ickntrvayplshiegalskaiaghpknvifltndafgvmppvarltsaqamfwfvmgyt
    anvpgveaggtrtarpifsscfggpflvrhatfygeqlaekmqkhnsrvwllntgyaggr
    adrgakrmplrvtraiidaihdgtldrteyeeypgwglhipkyvakvpehllnprkawkd
    vrqfnetskelvamfqesfsarfaakasqemksavpryvefa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ii2B (B:)
    pptihrnllspelvqwalkiekdsrltargalavmsyaktgrspldkrivdtddvrenvd
    wgkvnmklseesfarvrkiakefldtrehlfvvdcfaghderyrlkvrvfttrpyhalfm
    rdmlivptpeelatfgepdyviynageckadpsipgltsttcvalnfktreqvilgteya
    gemkkgiltvmfelmpqmnhlcmhasanvgkqgdvtvffglsgtgkttlsadphrnligd
    dehvwtdrgvfnieggcyakaiglnpktekdiydavrfgavaencvldkrtgeidfydes
    ickntrvayplshiegalskaiaghpknvifltndafgvmppvarltsaqamfwfvmgyt
    anvpgveaggtrtarpifsscfggpflvrhatfygeqlaekmqkhnsrvwllntgyaggr
    adrgakrmplrvtraiidaihdgtldrteyeeypgwglhipkyvakvpehllnprkawkd
    vrqfnetskelvamfqesfsarfaakasqemksavpryvefarl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ii2B (B:)
    pptihrnllspelvqwalkiekdsrltargalavmsyaktgrspldkrivdtddvrenvd
    wgkvnmklseesfarvrkiakefldtrehlfvvdcfaghderyrlkvrvfttrpyhalfm
    rdmlivptpeelatfgepdyviynageckadpsipgltsttcvalnfktreqvilgteya
    gemkkgiltvmfelmpqmnhlcmhasanvgkqgdvtvffglsgtgkttlsadphrnligd
    dehvwtdrgvfnieggcyakaiglnpktekdiydavrfgavaencvldkrtgeidfydes
    ickntrvayplshiegalskaiaghpknvifltndafgvmppvarltsaqamfwfvmgyt
    anvptarpifsscfggpflvrhatfygeqlaekmqkhnsrvwllntgyaggradrgakrm
    plrvtraiidaihdgtldrteyeeypgwglhipkyvakvpehllnprkawkdvrqfnets
    kelvamfqesfsarfaakasqemksavpryvefa