PDB entry 1iho

View 1iho on RCSB PDB site
Description: crystal apo-structure of pantothenate synthetase from e. coli
Deposited on 2001-04-19, released 2001-05-30
The last revision prior to the SCOP 1.61 freeze date was dated 2001-05-30, with a file datestamp of 2001-05-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1ihoa_
  • Chain 'B':
    Domains in SCOP 1.61: d1ihob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihoA (A:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvel
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihoB (B:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvel