PDB entry 1iho

View 1iho on RCSB PDB site
Description: crystal apo-structure of pantothenate synthetase from e. coli
Class: ligase
Keywords: Rossmann fold, dimer, apo, HIGH, KSMKS, flexible domains, multidomain, LIGASE
Deposited on 2001-04-19, released 2001-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pantoate--beta-alanine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ihoa_
  • Chain 'B':
    Compound: Pantoate--beta-alanine ligase
    Species: Escherichia coli [TaxId:562]
    Gene: panC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ihob_
  • Heterogens: TRS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihoA (A:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvela
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihoA (A:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ihoB (B:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvela
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihoB (B:)
    mliietlpllrqqirrlrmegkrvalvptmgnlhdghmklvdeakaradvvvvsifvnpm
    qfdrpedlaryprtlqedceklnkrkvdlvfapsvkeiypngtethtyvdvpglstmleg
    asrpghfrgvstivsklfnlvqpdiacfgekdfqqlalirkmvadmgfdieivgvpimra
    kdglalssrngyltaeqrkiapglykvlssiadklqagerdldeiitiagqelnekgfra
    ddiqirdadtllevsetskravilvaawlgdarlidnkmvel