PDB entry 1ihf

View 1ihf on RCSB PDB site
Description: integration host factor/DNA complex
Class: transcription/DNA
Keywords: complex (transcription regulation-DNA), transcription factor, beta ribbon motif, DNA bending protein, transcription-DNA complex
Deposited on 1996-08-21, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (integration host factor (alpha) (ihf))
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ihfa_
  • Chain 'B':
    Compound: protein (integration host factor (beta) (ihf))
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ihfb_
  • Chain 'C':
    Compound: DNA (35-mer)
  • Chain 'D':
    Compound: DNA (5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*tp*gp*c p*ap*cp*c)-3')
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihfA (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihfA (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihfB (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.