PDB entry 1ihf

View 1ihf on RCSB PDB site
Description: integration host factor/dna complex
Deposited on 1996-08-21, released 1997-02-12
The last revision prior to the SCOP 1.65 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.192
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ihfa_
  • Chain 'B':
    Domains in SCOP 1.65: d1ihfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ihfA (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ihfA (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ihfB (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg