PDB entry 1igy

View 1igy on RCSB PDB site
Description: structure of immunoglobulin
Deposited on 1997-10-09, released 1998-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.211
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyA (A:)
    kcahtvsksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpdr
    ftgsgsatdftltissvqaedladyhcgqgysypytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyB (B:)
    vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
    qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifppkpkd
    tllitvtpkvtcvvvdiskddpevqfswfvdnvevhtaqtqpreeqfnstfrvvsalpim
    hqdwlngkefkcrvnsaafpapiektisktkgkprapqvytipppkeqmakdkvsltcmi
    tdffpeditvewqsdgqapenykntqpimdtdgsyfvysklnvqksnweagntftcsvlh
    eglhnhhtekslsh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyC (C:)
    kcahtvsksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpdr
    ftgsgsatdftltissvqaedladyhcgqgysypytfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igyD (D:)
    vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
    qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvssakttpp
    svyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlss
    svtvpssprpsetvtcnvahpasstkvdkkivprdcgckpcictvpevssvfifppkpkd
    tllitvtpkvtcvvvdiskddpevqfswfvdnvevhtaqtqpreeqfnstfrvvsalpim
    hqdwlngkefkcrvnsaafpapiektisktkgkprapqvytipppkeqmakdkvsltcmi
    tdffpeditvewqsdgqapenykntqpimdtdgsyfvysklnvqksnweagntftcsvlh
    eglhnhhtekslsh