PDB entry 1igr

View 1igr on RCSB PDB site
Description: Type 1 Insulin-like growth factor receptor (DOMAINS 1-3)
Class: hormone receptor
Keywords: hormone receptor, insulin receptor family
Deposited on 1998-09-28, released 1999-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.237
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin-like growth factor receptor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1igra1, d1igra2, d1igra3
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1igrA (A:)
    eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv
    agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc
    ylstvdwslildavsnnyivgnkppkecgdlcpgtmeekpmcekttinneynyrcwttnr
    cqkmcpstcgkractennecchpeclgscsapdndtacvacrhyyyagvcvpacppntyr
    fegwrcvdrdfcanilsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpcpk
    vceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvki
    rhshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfaf
    npklcvseiyrmeevtgtkgrqskgdintrnngerascesdvddddkeqkliseedln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1igrA (A:)
    eicgpgidirndyqqlkrlenctviegylhilliskaedyrsyrfpkltviteylllfrv
    agleslgdlfpnltvirgwklfynyalvifemtnlkdiglynlrnitrgairieknadlc
    ylstvdwslildavsnnyivgnkppkecgdlcpgtmeekpmcekttinneynyrcwttnr
    cqkmcpstcgkractennecchpeclgscsapdndtacvacrhyyyagvcvpacppntyr
    fegwrcvdrdfcanilsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpcpk
    vceeekktktidsvtsaqmlqgctifkgnllinirrgnniaselenfmglievvtgyvki
    rhshalvslsflknlrlilgeeqlegnysfyvldnqnlqqlwdwdhrnltikagkmyfaf
    npklcvseiyrmeevtgtkgrqskgdintrnngerascekeqkliseedln