PDB entry 1igm
View 1igm on RCSB PDB site
Description: three dimensional structure of an fv from a human igm immunoglobulin
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on
1992-07-10, released
1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-08-25, with a file datestamp of
2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'H':
Compound: igm-kappa pot fv (heavy chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1igmh_ - Chain 'L':
Compound: igm-kappa pot fv (light chain)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- GB AAD44145 (0-114)
- conflict (33)
- conflict (44)
- conflict (46)
- conflict (48-49)
- conflict (91)
- conflict (99)
- conflict (104)
Domains in SCOPe 2.05: d1igml_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>1igmH (H:)
evhllesggnlvqpggslrlscaasgftfnifvmswvrqapgkglewvsgvfgsggntdy
adavkgrftitrdnskntlylqmnslraedtaiyycakhrvsyvltgfdswgqgtlvtvs
sgsasaptl
- Chain 'L':
Sequence; same for both SEQRES and ATOM records: (download)
>1igmL (L:)
diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv