PDB entry 1igm

View 1igm on RCSB PDB site
Description: three dimensional structure of an fv from a human igm immunoglobulin
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-07-10, released 1993-10-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igm-kappa pot fv (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1IGM (0-128)
    Domains in SCOPe 2.03: d1igmh_
  • Chain 'L':
    Compound: igm-kappa pot fv (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAD44145 (0-114)
      • conflict (33)
      • conflict (44)
      • conflict (46)
      • conflict (48-49)
      • conflict (91)
      • conflict (99)
      • conflict (104)
    Domains in SCOPe 2.03: d1igml_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igmH (H:)
    evhllesggnlvqpggslrlscaasgftfnifvmswvrqapgkglewvsgvfgsggntdy
    adavkgrftitrdnskntlylqmnslraedtaiyycakhrvsyvltgfdswgqgtlvtvs
    sgsasaptl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igmL (L:)
    diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
    rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv