PDB entry 1igm

View 1igm on RCSB PDB site
Description: three dimensional structure of an fv from a human igm immunoglobulin
Deposited on 1992-07-10, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Domains in SCOP 1.55: d1igmh_
  • Chain 'L':
    Domains in SCOP 1.55: d1igml_

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igmH (H:)
    evhllesggnlvqpggslrlscaasgftfnifvmswvrqapgkglewvsgvfgsggntdy
    adavkgrftitrdnskntlylqmnslraedtaiyycakhrvsyvltgfdswgqgtlvtvs
    sgsasaptl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igmL (L:)
    diqmtqspsslsasvgdrvtitcqasqdisnylawyqqkpgkapelriydasnletgvps
    rfsgsgsgtdftftisslqpediatyycqqyqnlpltfgpgtkvdikrtvaapsv