PDB entry 1igi

View 1igi on RCSB PDB site
Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity
Deposited on 1993-02-19, released 1993-04-15
The last revision prior to the SCOP 1.63 freeze date was dated 1994-10-15, with a file datestamp of 1994-10-26.
Experiment type: -
Resolution: 2.7 Å
R-factor: 0.177
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igiH (H:)
    vqlqqsgpelvkpgasvrmsckssgyiftdfymnwvrqshgksldyigyispysgvtgyn
    qkfkgkatltvdkssstaymelrsltsedsavyycagssgnkwamdywghgasvtvssak
    ttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdly
    tlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igiL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylnwylqkagqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgiyfcsqtthvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne