PDB entry 1igd

View 1igd on RCSB PDB site
Description: the third igg-binding domain from streptococcal protein g: an analysis by x-ray crystallography of the structure alone and in a complex with fab
Deposited on 1994-08-05, released 1994-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 1.1 Å
R-factor: 0.193
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1igd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1igd_ (-)
    mtpavttyklvingktlkgetttkavdaetaekafkqyandngvdgvwtyddatktftvt
    e