PDB entry 1ifr

View 1ifr on RCSB PDB site
Description: Structure of Lamin A/C Globular Domain
Class: immune system
Keywords: immunoglobulin, IMMUNE SYSTEM
Deposited on 2001-04-13, released 2002-07-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.216
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lamin A/C
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02545 (4-End)
      • cloning artifact (0-3)
    Domains in SCOPe 2.07: d1ifra1, d1ifra2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1ifrA (A:)
gshrtsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkftlka
gqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrsvtvve
d

    Sequence, based on observed residues (ATOM records): (download) 
    >1ifrA (A:)
gshrtsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkftlka
gqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklv