PDB entry 1ifp

View 1ifp on RCSB PDB site
Description: inovirus (filamentous bacteriophage) strain pf3 major coat protein assembly
Class: Virus
Keywords: VIRUS COAT PROTEIN, Helical virus
Deposited on 1998-01-22, released 1998-11-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-01-26, with a file datestamp of 2010-01-22.
Experiment type: FIBER
Resolution: 3.1 Å
R-factor: 0.17
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major coat protein assembly
    Species: Pseudomonas phage Pf3 [TaxId:10872]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ifpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifpA (A:)
    mqsvitdvtgqltavqadittiggaiivlaavvlgirwikaqff