PDB entry 1ifh

View 1ifh on RCSB PDB site
Description: a detailed analysis of the free and bound conformation of an antibody: x-ray structures of anti-peptide fab 17(slash)9 and three different fab-peptide complexes
Deposited on 1993-05-06, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.17
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifhH (H:)
    evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
    pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvsa
    akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ifhL (L:)
    divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkradaapt
    vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
    msstltltkdeyerhnsytceathktstspivksfnrn