PDB entry 1ieb

View 1ieb on RCSB PDB site
Description: histocompatibility antigen
Deposited on 1996-04-05, released 1997-06-05
The last revision prior to the SCOP 1.67 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iebA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iebB (B:)
    rdsrdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryf
    ynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflv
    prrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrng
    dwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebB (B:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iebC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    eektllpetken
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iebD (D:)
    rdsrdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryf
    ynleenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflv
    prrveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrng
    dwtfqtlvmletvpqsgevytcqvehpsltdpvtvewkaqstsaqnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iebD (D:)
    rdrmvnhfiaefkrkggslvprgsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew