PDB entry 1iea

View 1iea on RCSB PDB site
Description: histocompatibility antigen
Deposited on 1996-04-05, released 1997-06-05
The last revision prior to the SCOP 1.55 freeze date was dated 1997-06-05, with a file datestamp of 1997-06-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.202
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ieaA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ieaB (B:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ieaC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ieaD (D:)
    gkkvitafneglkggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfynl
    eenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvprr
    veptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdwt
    fqtlvmletvpqsgevytcqvehpsltdpvtvew