PDB entry 1ie5

View 1ie5 on RCSB PDB site
Description: nmr structure of the third immunoglobulin domain from the neural cell adhesion molecule.
Deposited on 2001-04-06, released 2001-08-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1ie5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ie5A (A:)
  gkdiqvivnvppsvrarqstmnatanlsqsvtlacdadgfpeptmtwtkdgepieqedne
  ekysfnydgseliikkvdksdeaeyiciaenkageqdatihlkvfak