PDB entry 1idh

View 1idh on RCSB PDB site
Description: the nmr solution structure of the complex formed between alpha-bungarotoxin and an 18mer cognate peptide
Class: toxin
Keywords: alpha-bungarotoxin, nicotinic acetylcholine receptor, alpha 1 subunit, nmr, protein-protein interaction, cation-pi interaction
Deposited on 2001-04-04, released 2001-04-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: alpha-bungarotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60615 (0-73)
  Domains in SCOPe 2.08: d1idha_
• Chain 'B':
  Compound: acetylcholine receptor protein, alpha chain
  Species: Torpedo californica [TaxId:7787]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02710 (0-17)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1idhA (A:)
  ivchttatspisavtcppgenlcyrkmwcdafcssrgkvvelgcaatcpskkpyeevtcc
  stdkcnphpkqrpg
  

  
  
• Chain 'B':
  No sequence available.