PDB entry 1icx

View 1icx on RCSB PDB site
Description: crystal structure of pathogenesis-related protein llpr10.1a from yellow lupine
Class: allergen
Keywords: 7-stranded beta sheet, C-terminal helix
Deposited on 2001-04-02, released 2002-07-10
The last revision prior to the SCOP 1.75 freeze date was dated 2002-07-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein llr18a
  Species: Lupinus luteus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52778 (0-154)
  Domains in SCOP 1.75: d1icxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icxA (A:)
  gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
  ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
  tkgdvlsetvrdqakfkglglfkaiegyvlahpdy