PDB entry 1icx

View 1icx on RCSB PDB site
Description: crystal structure of pathogenesis-related protein llpr10.1a from yellow lupine
Class: allergen
Keywords: 7-stranded beta sheet, C-terminal helix, ALLERGEN
Deposited on 2001-04-02, released 2002-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.196
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein llr18a
  Species: Lupinus luteus [TaxId:3873]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52778 (0-154)
  Domains in SCOPe 2.08: d1icxa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1icxA (A:)
  gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
  ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
  tkgdvlsetvrdqakfkglglfkaiegyvlahpdy