PDB entry 1ibx

View 1ibx on RCSB PDB site
Description: nmr structure of dff40 and dff45 n-terminal domain complex
Class: hydrolase/hydrolase inhibitor
Keywords: DFF40, DFF45, protein-protein complex, CIDE, CIDE domain complex, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2001-03-29, released 2001-05-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -3.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA fragmentation factor 40
    Species: Homo sapiens [TaxId:9606]
    Gene: DFF40
    Database cross-references and differences (RAF-indexed):
    • Uniprot O76075 (0-79)
      • expression tag (80)
    Domains in SCOPe 2.08: d1ibxa1, d1ibxa2
  • Chain 'B':
    Compound: chimera of igg binding protein g and DNA fragmentation factor 45
    Species: Streptococcus sp., Homo sapiens [TaxId:1306,9606]
    Gene: DFF45
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909
    • GB AAC51249 (56-144)
    Domains in SCOPe 2.08: d1ibxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ibxA (A:)
    mlqkpksvklralrsprkfgvagrscqevlrkgclrfqlpergsrlclyedgteltedyf
    psvpdnaelvlltlgqawqghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ibxA (A:)
    mlqkpksvklralrsprkfgvagrscqevlrkgclrfqlpergsrlclyedgteltedyf
    psvpdnaelvlltlgqawqgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ibxB (B:)
    mqyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvtesgei
    rtlkpcllrrnysreqhgvaascledlrskacdilaidksltpvtlvlaedgtivddddy
    flclpsntkfvalasnekwaynnsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ibxB (B:)
    sgeirtlkpcllrrnysreqhgvaascledlrskacdilaidksltpvtlvlaedgtivd
    dddyflclpsntkfvalasnekwaynnsd