PDB entry 1ib6

View 1ib6 on RCSB PDB site
Description: crystal structure of r153c e. coli malate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase, malate dehydrogenase, substrate specificity
Deposited on 2001-03-27, released 2001-09-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.06: d1ib6a1, d1ib6a2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.06: d1ib6b1, d1ib6b2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.06: d1ib6c1, d1ib6c2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: MDH
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61889 (0-311)
      • engineered (152)
      • see remark 999 (306)
    Domains in SCOPe 2.06: d1ib6d1, d1ib6d2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6A (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6B (B:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6C (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6D (D:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk