PDB entry 1ib6

View 1ib6 on RCSB PDB site
Description: crystal structure of r153c e. coli malate dehydrogenase
Deposited on 2001-03-27, released 2001-09-19
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-19, with a file datestamp of 2001-09-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6A (A:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6B (B:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6C (C:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ib6D (D:)
    mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
    edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
    vnttvaiaaevlkkagvydknklfgvttldiicsntfvaelkgkqpgevevpvigghsgv
    tilpllsqvpgvsfteqevadltkriqnagtevveakagggsatlsmgqaaarfglslvr
    alqgeqgvvecayvegdgqyarffsqplllgkngveerksigtlsafeqnalegmldtlk
    kdialgqefvnk