PDB entry 1ias

View 1ias on RCSB PDB site
Description: cytoplasmic domain of unphosphorylated type i tgf-beta receptor crystallized without fkbp12
Deposited on 2001-03-23, released 2001-10-03
The last revision prior to the SCOP 1.69 freeze date was dated 2001-10-03, with a file datestamp of 2001-10-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.255
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1iasa_
  • Chain 'B':
    Domains in SCOP 1.69: d1iasb_
  • Chain 'C':
    Domains in SCOP 1.69: d1iasc_
  • Chain 'D':
    Domains in SCOP 1.69: d1iasd_
  • Chain 'E':
    Domains in SCOP 1.69: d1iase_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iasA (A:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iasA (A:)
    isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
    vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
    ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
    dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
    iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
    mrecwyangaarltalrikktlsqlsqqeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iasB (B:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iasB (B:)
    isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
    vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
    ylnrytvtvegmiklalstasglahlhmeigkpaiahrdlksknilvkkngtcciadlgl
    avrhdsatdtidihrvgtkrymapevlddsinmkhfesfkradiyamglvfweiarrcsi
    ggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmakimrecwya
    ngaarltalrikktlsqlsqqegi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iasC (C:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iasC (C:)
    isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
    vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
    ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
    dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
    iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
    mrecwyangaarltalrikktlsqlsqqeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iasD (D:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iasD (D:)
    isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
    vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
    ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
    dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
    iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
    mrecwyangaarltalrikktlsqlsqqeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iasE (E:)
    edpsldrpfisegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwr
    gkwrgeevavkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsd
    yhehgslfdylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilv
    kkngtcciadlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradi
    yamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqsc
    ealrvmakimrecwyangaarltalrikktlsqlsqqegikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iasE (E:)
    isegttlkdliydmttsgsgsglpllvqrtiartivlqesigkgrfgevwrgkwrgeeva
    vkifssreerswfreaeiyqtvmlrhenilgfiaadnkdngtwtqlwlvsdyhehgslfd
    ylnrytvtvegmiklalstasglahlhmeivgtqgkpaiahrdlksknilvkkngtccia
    dlglavrhdsatdtidiapnhrvgtkrymapevlddsinmkhfesfkradiyamglvfwe
    iarrcsiggihedyqlpyydlvpsdpsveemrkvvceqklrpnipnrwqscealrvmaki
    mrecwyangaarltalrikktlsqlsqqeg