PDB entry 1iao

View 1iao on RCSB PDB site
Description: class ii mhc i-ad in complex with ovalbumin peptide 323-339
Deposited on 1998-03-13, released 1998-11-04
The last revision prior to the SCOP 1.55 freeze date was dated 1998-11-25, with a file datestamp of 1998-11-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.255
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaoA (A:)
    eadhvgfygttvyqspgdigqythefdgdelfyvdldkkktvwrlpefgqlilfepqggl
    qniaaekhnlgiltkrsnftpatneapqatvfpkspvllgqpntlicfvdnifppvinit
    wlrnsksvtdgvyetsflvnrdhsfhklsyltfipsdddiydckvehwgleepvlkhw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iaoB (B:)
    rgisqavhaahaeineagrgsgsgsgnserhfvvqfkgecyytngtqrirlvtryiynre
    eyvrydsdvgeyravtelgrpdaeywnsqpeildrtraevdtacrhnyegpetstslrrl
    eqpnvaislsrtealnhhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwt
    fqvlvmlemtphqgevytchvehpslkspitvewss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iaoB (B:)
    rgisqavhaahaeihfvvqfkgecyytngtqrirlvtryiynreeyvrydsdvgeyravt
    elgrpdaeywnsqpeildrtraevdtacrhnyegpetstslrrleqpnvaislsrtealn
    hhntlvcsvtdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtphqgev
    ytchvehpslkspitvewss