PDB entry 1ian

View 1ian on RCSB PDB site
Description: human p38 map kinase inhibitor complex
Class: serine/threonine-protein kinase
Keywords: protein ser/thr-kinase, serine/threonine-protein kinase
Deposited on 1997-03-07, released 1998-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.234
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p38 map kinase
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1iana_
  • Heterogens: D13

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ianA (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ianA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivtddhvqf
    liyqilrglkyihsadiihrdlkpsnlavnedcelkildftrwyrapeimlnwmhynqtv
    diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
    mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
    qsfesrdllidewksltydevisfvppp