PDB entry 1iak

View 1iak on RCSB PDB site
Description: histocompatibility antigen I-ak
Class: histocompatibility antigen I-ak
Keywords: histocompatibility antigen, MHC, peptide complex, histocompatibility antigen I-ak
Deposited on 1997-11-18, released 1998-04-15
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II I-ak
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1iaka1, d1iaka2
  • Chain 'B':
    Compound: MHC class II I-ak
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06343 (0-184)
      • conflict (0)
      • conflict (175)
    Domains in SCOPe 2.02: d1iakb1, d1iakb2
  • Chain 'P':
    Compound: MHC class II I-ak
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iakA (A:)
    eddieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfep
    qgglqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlk
    hwepeipapmseltetvvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iakA (A:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iakB (B:)
    gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
    ylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdfypa
    kikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpsltspit
    vewra
    

  • Chain 'P':
    No sequence available.