PDB entry 1iak

View 1iak on RCSB PDB site
Description:
Deposited on 1997-11-18, released 1998-04-15
The last revision prior to the SCOP 1.67 freeze date was dated 1998-04-15, with a file datestamp of 1998-04-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1iaka1, d1iaka2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1iakb1, d1iakb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iakA (A:)
    eddieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfep
    qgglqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlk
    hwepeipapmseltetvvc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iakA (A:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iakB (B:)
    gsfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeywnkq
    ylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdfypa
    kikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpsltspit
    vewra