PDB entry 1iai

View 1iai on RCSB PDB site
Description: idiotype-anti-idiotype fab complex
Deposited on 1993-12-28, released 1996-03-08
The last revision prior to the SCOP 1.59 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiH (H:)
    qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmawintytgepty
    addfkgrfafsletsastaylqinnlknedtatyfcardgyyenyyamdywgqgtsvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtssttpsqsitcnvahpasstkvdkkid
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiI (I:)
    evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
    hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpstwrpsetvtcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiL (L:)
    divmtqshkfmstsvgdrvsitckasqdvstavawyqqkpgqspklliysasyqytgvpd
    rftgsgsrtdftftinsvqaedlavyychqhystpftfgsgtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iaiM (M:)
    diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
    vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrnec