PDB entry 1iag

View 1iag on RCSB PDB site
Description: first structure of a snake venom metalloproteinase: a prototype for matrix metalloproteinases(slash)collagenases
Class: metalloprotease
Keywords: metalloprotease
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.172
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adamalysin II
    Species: Crotalus adamanteus [TaxId:8729]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34179 (1-201)
      • conflict (41)
    Domains in SCOPe 2.08: d1iaga_
  • Heterogens: ZN, CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iagA (A:)
    enlpqryielvvvadrrvfmkynsdlniirtrvheivniinkfyrslnirvsltdleiws
    gqdfitiqssssntlnsfgewrervlliwkrhdnaqlltainfegkiigkaytssmcnpr
    ssvgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsd
    dsmgyyqkflnqykpqcilnkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iagA (A:)
    nlpqryielvvvadrrvfmkynsdlniirtrvheivniinkfyrslnirvsltdleiwsg
    qdfitiqssssntlnsfgewrervlliwkrhdnaqlltainfegkiigkaytssmcnprs
    svgivkdhspinllvavtmahelghnlgmehdgkdclrgaslcimrpgltpgrsyefsdd
    smgyyqkflnqykpqcilnkp