PDB entry 1iad

View 1iad on RCSB PDB site
Description: refined 1.8 angstroms x-ray crystal structure of astacin, a zinc-endopeptidase from the crayfish astacus astacus l. structure determination, refinement, molecular structure and comparison to thermolysin
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.155
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1iad__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iad_ (-)
  aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
  gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
  dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
  hmlqtdanqinnlytnecsl