PDB entry 1iab

View 1iab on RCSB PDB site
Description: crystal structures, spectroscopic features, and catalytic properties of cobalt(ii), copper(ii), nickel(ii), and mercury(ii) derivatives of the zinc endopeptidase astacin. a correlation of structure and proteolytic activity
Deposited on 1994-05-09, released 1994-08-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-08-31, with a file datestamp of 1994-09-15.
Experiment type: -
Resolution: 1.79 Å
R-factor: 0.158
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1iab__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iab_ (-)
  aailgdeylwsggvipytfagvsgadqsailsgmqeleektcirfvprttesdyveifts
  gsgcwsyvgrisgaqqvslqangcvyhgtiihelmhaigfyhehtrmdrdnyvtinyqnv
  dpsmtsnfdidtysryvgedyqyysimhygkysfsiqwgvletivplqngidltdpydka
  hmlqtdanqinnlytnecsl