PDB entry 1i9w

View 1i9w on RCSB PDB site
Description: crystal structure of the fusion glycoprotein e1 from semliki forest virus
Deposited on 2001-03-21, released 2002-04-06
The last revision prior to the SCOP 1.71 freeze date was dated 2002-04-06, with a file datestamp of 2002-04-06.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.275
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9wA (A:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppkdhivpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9wA (A:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthsvltltyktnkngdcsvhshsnvatlqeatakvtlhfstasaspsfvvslcs
    aratcsasc