PDB entry 1i9r

View 1i9r on RCSB PDB site
Description: structure of cd40l in complex with the fab fragment of humanized 5c8 antibody
Deposited on 2001-03-20, released 2002-03-20
The last revision prior to the SCOP 1.63 freeze date was dated 2002-05-22, with a file datestamp of 2002-05-22.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.233
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rA (A:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rB (B:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rC (C:)
    npqiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfc
    snreassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvf
    vnvtdpsqvshgtgftsfgllkl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rH (H:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rK (K:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rL (L:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rM (M:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rX (X:)
    qvqlvqsgaevvkpgasvklsckasgyiftsyymywvkqapgqglewigeinpsngdtnf
    nekfkskatltvdksastaymelsslrsedtavyyctrsdgrndmdswgqgtlvtvssas
    tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
    yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i9rY (Y:)
    divltqspatlsvspgeratiscrasqrvssstysymhwyqqkpgqppkllikyasnles
    gvparfsgsgsgtdftltissvepedfatyycqhsweipptfgggtkleikrtvaapsvf
    ifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysls
    stltlskadyekhkvyacevthqglsspvtksfnr