PDB entry 1i9n

View 1i9n on RCSB PDB site
Description: carbonic anhydrase II (f131v) complexed with 4-(aminosulfonyl)-n-[(2,5-difluorophenyl)methyl]-benzamide
Class: lyase
Keywords: Human Carbonic Anhydrase II, 4-(aminosulfonyl)-N-[(2,5-difluorophenyl)methyl]-benzamide, LYASE
Deposited on 2001-03-20, released 2001-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.221
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (Start-258)
      • engineered (128)
    Domains in SCOPe 2.07: d1i9na_
  • Heterogens: ZN, HG, IOA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1i9nA (A:)
    shhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslriln
    nghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlv
    hwntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdpr
    gllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmv
    dnwrpaqplknrqikasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1i9nA (A:)
    hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
    ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvh
    wntkygdvgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
    llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
    nwrpaqplknrqikasfk