PDB entry 1i9e

View 1i9e on RCSB PDB site
Description: tcr domain
Class: immune system
Keywords: Ig-like domain, T Cell receptor, IMMUNE SYSTEM
Deposited on 2001-03-19, released 2001-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytotoxic tcell valpha domain
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01738 (0-114)
  Domains in SCOPe 2.02: d1i9ea_
• Heterogens: NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1i9eA (A:)
  qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
  gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqn