PDB entry 1i92

View 1i92 on RCSB PDB site
Description: structural basis of the nherf pdz1-cftr interaction
Class: signaling protein
Keywords: pdz, cftr, nherf, crystal structure, complex, signaling protein
Deposited on 2001-03-16, released 2001-06-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: na+/h+ exchange regulatory co-factor
    Species: Homo sapiens [TaxId:9606]
    Gene: NHERF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (2-85)
      • cloning artifact (0-1)
    • GB NP_000483 (86-90)
    Domains in SCOPe 2.06: d1i92a1, d1i92a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1i92A (A:)
gmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
kethqqvvsriraalnavrllvvdpeqdtrl