PDB entry 1i8x

View 1i8x on RCSB PDB site
Description: semi-automatic structure determination of the cg1 1-30 peptide based on aria
Deposited on 2001-03-16, released 2002-04-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-17, with a file datestamp of 2002-04-17.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1i8xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1i8xA (A:)
    vihcdaaticpdgttcslspygvwycspfs